Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PIN4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 52-131 of human PIN4 (Q9Y237) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PIN4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 52-131 of human PIN4 (Q9Y237) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13325A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PIN4 |
| Target Synonyms | EPVH; PAR14; PAR17; hEPVH; hPar14; hPar17; PIN4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, HepG2, Mouse liver, Rat thymus, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 52-131 of human PIN4 (Q9Y237). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK | Uniprot ID | Q9Y237 |
Uniprot Id
Q9Y237
Target Species
Human
Target Name
PIN4
Target Full Name
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4
Target Function
Isoform 1 is involved as a ribosomal RNA processing factor in ribosome biogenesis. Binds to tightly bent AT-rich stretches of double-stranded DNA.; Isoform 2 binds to double-stranded DNA.
Target Subcellular Location
[Isoform 1]: Nucleus, nucleolus. Cytoplasm, cytoskeleton, spindle. Cytoplasm. Note=Colocalizes in the nucleolus during interphase and on the spindle apparatus during mitosis with NPM1.; [Isoform 2]: Mitochondrion. Mitochondrion matrix. Note=Imported in a time- and membrane potential-dependent manner to the mitochondrial matrix, but without concomitant processing of the protein. Directed to mitochondria by a novel N-terminal domain that functions as non-cleavable mitochondrial targeting peptide.
Target Protein Families
PpiC/parvulin rotamase family, PIN4 subfamily
Target Tissue Specificity
Isoform 2 is much more stable than isoform 1 (at protein level). Ubiquitous. Isoform 1 and isoform 2 are expressed in kidney, liver, blood vessel, brain, mammary gland, skeletal muscle, small intestine and submandibularis. Isoform 1 transcripts are much m
Target Synonyms
EPVH; PAR14; PAR17; hEPVH; hPar14; hPar17; PIN4
Target Background
This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle, chromatin remodeling, and/or ribosome biogenesis. The encoded protein may play an additional role in the mitochondria.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
