-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MEIS2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEIS2 (O14770) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MEIS2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEIS2 (O14770) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14143A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MEIS2 |
| Target Synonyms | MRG1; CPCMR; HsT18361; MEIS2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse lung, SKOV3, U-87MG, U-937 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEIS2 (O14770). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELAT | Uniprot ID | O14770 |
Uniprot Id
O14770
Target Species
Human
Target Name
MEIS2
Target Full Name
Homeobox protein Meis2
Target Function
Involved in transcriptional regulation. Binds to HOX or PBX proteins to form dimers, or to a DNA-bound dimer of PBX and HOX proteins and thought to have a role in stabilization of the homeoprotein-DNA complex. Isoform 3 is required for the activity of a PDX1:PBX1b:MEIS2b complex in pancreatic acinar cells involved in the transcriptional activation of the ELA1 enhancer; the complex binds to the enhancer B element and cooperates with the transcription factor 1 complex (PTF1) bound to the enhancer A element; MEIS2 is not involved in complex DNA-binding. Probably in complex with PBX1, is involved in transcriptional regulation by KLF4. Isoform 3 and isoform 4 can bind to a EPHA8 promoter sequence containing the DNA motif 5'-CGGTCA-3'; in cooperation with a PBX protein (such as PBX2) is proposed to be involved in the transcriptional activation of EPHA8 in the developing midbrain. May be involved in regulation of myeloid differentiation. Can bind to the DNA sequence 5'-TGACAG-3'in the activator ACT sequence of the D(1A) dopamine receptor (DRD1) promoter and activate DRD1 transcription; isoform 5 cannot activate DRD1 transcription.
Target Involvement
Cleft palate, cardiac defects, and mental retardation (CPCMR)
Target Subcellular Location
Nucleus. Cytoplasm, perinuclear region.
Target Protein Families
TALE/MEIS homeobox family
Target Tissue Specificity
Expressed in various tissues. Expressed at high level in the lymphoid organs of hematopoietic tissues. Also expressed in some regions of the brain, such as the putamen.
Target Synonyms
Homeobox protein Meis2; HsT18361 ; Meis (mouse) homolog 2 ; Meis homeobox 2; Meis homolog 2; Meis1 myeloid ecotropic viral integration site 1 homolog 2 (mouse) ; Meis1 myeloid ecotropic viral integration site 1 homolog 2; Meis1 related gene 1; Meis1 related protein 1; Meis1-related protein 1; MEIS2; MEIS2_HUMAN; MGC2820 ; MRG1 ; TALE homeobox protein Meis2
Target Background
This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene.
Notification