Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VAV2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human VAV2 (P52735) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against VAV2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human VAV2 (P52735) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14150A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VAV2 |
| Target Synonyms | VAV-2; VAV2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, MCF7, Mouse liver, Mouse lung, Mouse spleen, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human VAV2 (P52735). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FDVRDFGKVISAVSRLSLHSIAQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEVQQPMIRYMQKMGMTEDDKRN | Uniprot ID | P52735 |
Uniprot Id
P52735
Target Species
Human
Target Name
VAV2
Target Full Name
Guanine nucleotide exchange factor VAV2
Target Function
Guanine nucleotide exchange factor for the Rho family of Ras-related GTPases. Plays an important role in angiogenesis. Its recruitment by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly.
Target Tissue Specificity
Widely expressed.
Target Synonyms
Guanine nucleotide exchange factor VAV2; Oncogene VAV2; Protein vav 2; VAV 2; Vav 2 oncogene; VAV-2; VAV2; VAV2 oncogene; VAV2_HUMAN
Target Background
VAV2 is the second member of the VAV guanine nucleotide exchange factor family of oncogenes. Unlike VAV1, which is expressed exclusively in hematopoietic cells, VAV2 transcripts were found in most tissues. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
