-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FUBP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 545-644 of human FUBP1 (Q96AE4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against FUBP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 545-644 of human FUBP1 (Q96AE4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14415A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FUBP1 |
| Target Synonyms | FBP; FUBP; hDH V; FUBP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 545-644 of human FUBP1 (Q96AE4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YQQQAQPPPAAPAGAPTTTQTNGQGDQQNPAPAGQVDYTKAWEEYYKKMGQAVPAPTGAPPGGQPDYSAAWAEYYRQQAAYYAQTSPQGMPQHPPAPQGQ | Uniprot ID | Q96AE4 |
Uniprot Id
Q96AE4
Target Species
Human
Target Name
FUBP1
Target Full Name
Far upstream element-binding protein 1
Target Function
Regulates MYC expression by binding to a single-stranded far-upstream element (FUSE) upstream of the MYC promoter. May act both as activator and repressor of transcription.
Target Subcellular Location
Nucleus.
Target Synonyms
DNA helicase V; far upstream element (FUSE) binding protein 1; Far upstream element (FUSE) binding protein 4; Far upstream element binding protein 1; far upstream element binding protein; Far upstream element-binding protein 1; FBP; FUBP; Fubp1; FUBP1_HUMAN; Fubp4; FUSE binding protein 1; FUSE-binding protein 1; HDH V
Target Background
The protein encoded by this gene is a single stranded DNA-binding protein that binds to multiple DNA elements, including the far upstream element (FUSE) located upstream of c-myc. Binding to FUSE occurs on the non-coding strand, and is important to the regulation of c-myc in undifferentiated cells. This protein contains three domains, an amphipathic helix N-terminal domain, a DNA-binding central domain, and a C-terminal transactivation domain that contains three tyrosine-rich motifs. The N-terminal domain is thought to repress the activity of the C-terminal domain. This protein is also thought to bind RNA, and contains 3'-5' helicase activity with in vitro activity on both DNA-DNA and RNA-RNA duplexes. Aberrant expression of this gene has been found in malignant tissues, and this gene is important to neural system and lung development. Binding of this protein to viral RNA is thought to play a role in several viral diseases, including hepatitis C and hand, foot and mouth disease. Alternative splicing results in multiple transcript variants.
Notification