-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PFKFB3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human PFKFB3 (NP_004557.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PFKFB3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human PFKFB3 (NP_004557.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14455A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PFKFB3 |
| Target Synonyms | PFK2; IPFK2; iPFK-2; PFKFB3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human PFKFB3 (NP_004557.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPT | Uniprot ID | Q16875 |
Uniprot Id
Q16875
Target Species
Human
Target Name
PFKFB3
Target Full Name
6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3
Target Function
Synthesis and degradation of fructose 2,6-bisphosphate.
Target Protein Families
Phosphoglycerate mutase family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
6 phosphofructo 2 kinase/ fructose 2,6 bisphosphatase; 6 phosphofructo 2 kinase/fructose 2,6 biphosphatase 3; 6-bisphosphatase; 6-P2ase 3; 6-P2ASE brain/placenta-type isozyme; 6PF 2 K/Fru 2,6 P2ASE brain/placenta type isozyme; 6PF 2-K/Fru 2,6 P2ase 3; 6PF-2-K/Fru-2; F263_HUMAN; fructose 6 phosphate,2 kinase/fructose 2; 6 bisphosphatase; Fructose-2; Inducible 6 phosphofructo 2 kinase/fructose 2,6 bisphosphatase; iPFK 2; iPFK-2; IPFK2; PFK/FBPase 3; PFK2; PFKFB3; Renal carcinoma antigen NY REN 56; Renal carcinoma antigen NY-REN-56; uPFK
Target Background
The protein encoded by this gene belongs to a family of bifunctional proteins that are involved in both the synthesis and degradation of fructose-2, 6-bisphosphate, a regulatory molecule that controls glycolysis in eukaryotes. The encoded protein has a 6-phosphofructo-2-kinase activity that catalyzes the synthesis of fructose-2, 6-bisphosphate (F2, 6BP), and a fructose-2, 6-biphosphatase activity that catalyzes the degradation of F2, 6BP. This protein is required for cell cycle progression and prevention of apoptosis. It functions as a regulator of cyclin-dependent kinase 1, linking glucose metabolism to cell proliferation and survival in tumor cells. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification