Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RANBP3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RANBP3 (Q9H6Z4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against RANBP3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RANBP3 (Q9H6Z4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
Immunohistochemistry analysis of paraffin-embedded mouse heart using RANBP3 Rabbit mAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
| Cat.No | ADA-14459A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RANBP3 |
| Target Synonyms | RANBP3; ran-binding protein 3 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RANBP3 (Q9H6Z4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHHGTGHPESAGEHALEPPAPAGASASTPPPPAPEAQLPPFPRELAGRSAGGS | Uniprot ID | Q9H6Z4 |
Uniprot Id
Q9H6Z4
Target Species
Human
Target Name
RANBP3
Target Full Name
Ran-binding protein 3
Target Function
Acts as a cofactor for XPO1/CRM1-mediated nuclear export, perhaps as export complex scaffolding protein. Bound to XPO1/CRM1, stabilizes the XPO1/CRM1-cargo interaction. In the absence of Ran-bound GTP prevents binding of XPO1/CRM1 to the nuclear pore complex. Binds to CHC1/RCC1 and increases the guanine nucleotide exchange activity of CHC1/RCC1. Recruits XPO1/CRM1 to CHC1/RCC1 in a Ran-dependent manner. Negative regulator of TGF-beta signaling through interaction with the R-SMAD proteins, SMAD2 and SMAD3, and mediating their nuclear export.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Tissue Specificity
Widely expressed with high levels in testis and heart.
Target Synonyms
DKFZp586I1520; Ran binding protein 3; Ran-binding protein 3; RANB3_HUMAN; RanBP3
Target Background
This gene encodes a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
