-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATP6AP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATP6AP1 (NP_001174.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ATP6AP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATP6AP1 (NP_001174.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14535A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATP6AP1 |
| Target Synonyms | 16A; CF2; Ac45; XAP3; XAP-3; ATP6S1; VATPS1; ATP6IP1; ATP6AP1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATP6AP1 (NP_001174.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MMAAMATARVRMGPRCAQALWRMPWLPVFLSLAAAAAAAAAEQQVPLVLWSSDRDLWAPAADTHEGHITSDLQLSTYLDPALELGPRNVLLFLQDKLSIE | Uniprot ID | Q15904 |
Uniprot Id
Q15904
Target Species
Human
Target Name
ATP6AP1
Target Full Name
V-type proton ATPase subunit S1
Target Function
Accessory subunit of the proton-transporting vacuolar (V)-ATPase protein pump, which is required for luminal acidification of secretory vesicles. Guides the V-type ATPase into specialized subcellular compartments, such as neuroendocrine regulated secretory vesicles or the ruffled border of the osteoclast, thereby regulating its activity. Involved in membrane trafficking and Ca(2+)-dependent membrane fusion. May play a role in the assembly of the V-type ATPase complex. In aerobic conditions, involved in intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation.
Target Involvement
Immunodeficiency 47 (IMD47)
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane.
Target Protein Families
Vacuolar ATPase subunit S1 family
Target Tissue Specificity
widely expressed, with highest levels in brain and lowest in liver and duodenum.
Target Synonyms
ATP6AP1; ATP6IP1; ATP6S1; VATPS1; XAP3; V-type proton ATPase subunit S1; V-ATPase subunit S1; Protein XAP-3; V-ATPase Ac45 subunit; V-ATPase S1 accessory protein; Vacuolar proton pump subunit S1
Target Background
This gene encodes a component of a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. Vacuolar ATPase (V-ATPase) is comprised of a cytosolic V1 (site of the ATP catalytic site) and a transmembrane V0 domain. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. The encoded protein of this gene may assist in the V-ATPase-mediated acidification of neuroendocrine secretory granules. This protein may also play a role in early development.
Notification