-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SEC24D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SEC24D (NP_001304995.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SEC24D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SEC24D (NP_001304995.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14571A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SEC24D |
| Target Synonyms | CLCRP2; SEC24D | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SEC24D (NP_001304995.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSQQGYVATPPYSQPQPGIGLSPPHYGHYGDPSHTASPTGMMKPAGPLGATATRGMLPPGPPPPGPHQFGQNGAHATGHPPQRFPGPPPVNNVASSHAPY | Uniprot ID | O94855 |
Uniprot Id
O94855
Target Species
Human
Target Name
SEC24D
Target Full Name
Protein transport protein Sec24D
Target Function
Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules for their transport to the Golgi complex. Plays a central role in cargo selection within the COPII complex and together with SEC24C may have a different specificity compared to SEC24A and SEC24B. May more specifically package GPI-anchored proteins through the cargo receptor TMED10. May also be specific for IxM motif-containing cargos like the SNAREs GOSR2 and STX5
Target Involvement
Cole-Carpenter syndrome 2 (CLCRP2)
Target Subcellular Location
Cytoplasmic vesicle, COPII-coated vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Endoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytosol.
Target Protein Families
SEC23/SEC24 family, SEC24 subfamily
Target Tissue Specificity
Ubiquitously expressed, with higher amounts in placenta, pancreas, heart and liver.
Target Synonyms
KIAA0755; Protein transport protein Sec24D; SC24D_HUMAN; SEC24 family member D; SEC24 related gene family; member D; SEC24-related protein D; SEC24D
Notification