Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AZI2 was raised in Rabbit using the recombinant protein containing a sequence corresponding to amino acids 282-387 of human AZI2 (NP_071906.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AZI2 was raised in Rabbit using the recombinant protein containing a sequence corresponding to amino acids 282-387 of human AZI2 (NP_071906.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14572A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AZI2 |
| Target Synonyms | AZ2; NAP1; TILP; AZI2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2, Mouse testis, Rat testis, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant protein containing a sequence corresponding to amino acids 282-387 of human AZI2 (NP_071906.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YTRHPPLLPNGKALCHTTSSPLPGDVKVLSEKAILQSWTDNERSIPNDGTCFQEHSSYGRNSLEDNSWVFPSPPKSSETAFGETKTKTLPLPNLPPLHYLDQHNQN | Uniprot ID | Q9H6S1 |
Uniprot Id
Q9H6S1
Target Species
Human
Target Name
AZI2
Target Full Name
5-azacytidine-induced protein 2
Target Function
Adapter protein which binds TBK1 and IKBKE playing a role in antiviral innate immunity. Activates serine/threonine-protein kinase TBK1 and facilitates its oligomerization. Enhances the phosphorylation of NF-kappa-B p65 subunit RELA by TBK1. Promotes TBK1-induced as well as TNF-alpha or PMA-induced activation of NF-kappa-B. Participates in IFNB promoter activation via TICAM1.
Target Subcellular Location
Cytoplasm.
Target Tissue Specificity
Widely expressed. Abundant expression seen in the pancreas and testis.
Target Synonyms
5 azacytidine induced protein 2; 5-azacytidine-induced protein 2; AA410145; AZ2; AZI2; AZI2_HUMAN; MGC112644; Nak associated protein 1; Nak-associated protein 1; NAP1; NF kappa B activating kinase associated protein 1; NF-kappa-B-activating kinase-associated protein 1; TILP; TILP(S)
Target Background
AZI2, or NAP1, contributes to the activation of NFKB (see MIM 164011)-dependent gene expression by activating IKK-related kinases, such as NAK (TBK1; MIM 604834) (Fujita et al., 2003 [PubMed 14560022]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
