-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DKK3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-200 of human DKK3 (NP_056965.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against DKK3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-200 of human DKK3 (NP_056965.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14787A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DKK3 |
| Target Synonyms | RIG; CRRL; REIC; DKK3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Mouse brain, SH-SY5Y | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 22-200 of human DKK3 (NP_056965.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMEDTQHKLRSAVEEMEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITNNQTGQMVFSETVITSVGDEEGRRSHECIIDEDCGPSMYCQFASFQYTCQPCRGQRMLCTRDSECCGDQLCVWGHCTKMAT | Uniprot ID | Q9UBP4 |
Uniprot Id
Q9UBP4
Target Species
Human
Target Name
DKK3
Target Full Name
Dickkopf-related protein 3
Target Function
Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.
Target Subcellular Location
Secreted.
Target Protein Families
Dickkopf family
Target Tissue Specificity
Highest expression in heart, brain, and spinal cord.
Target Synonyms
Dickkopf 3; Dickkopf 3 homolog (Xenopus laevis); Dickkopf 3 homolog; Dickkopf homolog 3; Dickkopf related protein 3; Dickkopf related protein 3 Precursor; Dickkopf WNT signaling pathway inhibitor 3; Dickkopf; Xenopus; homolog of; 3; Dickkopf-3; Dickkopf-related protein 3; Dickkopf3; DKK 3; Dkk-3; DKK3; DKK3_HUMAN; hDkk 3; hDkk-3; hDkk3; Regulated in glioma; REIC; RIG; RIG-like 5-6; RIG-like 7-1
Target Background
This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. The expression of this gene is decreased in a variety of cancer cell lines and it may function as a tumor suppressor gene. Alternative splicing results in multiple transcript variants encoding the same protein.
Notification