-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TIMP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human TIMP2 (NP_003246.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TIMP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human TIMP2 (NP_003246.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14928A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TIMP2 |
| Target Synonyms | DDC8; CSC-21K; TIMP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat, African green monkey | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | COS-7, HT-1080, Mouse lung, Mouse testis, Rat lung, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TIMP2 (NP_003246.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGS | Uniprot ID | P16035 |
Uniprot Id
P16035
Target Species
Human
Target Name
TIMP2
Target Full Name
Metalloproteinase inhibitor 2
Target Function
Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19.
Target Subcellular Location
Secreted.
Target Protein Families
Protease inhibitor I35 (TIMP) family
Target Research Area
Cardiovascular
Target Synonyms
CSC 21K; CSC-21K; CSC21K; Metalloproteinase inhibitor 2; Metalloproteinase inhibitor 2 precursor; TIMP 2; TIMP metallopeptidase inhibitor 2; TIMP-2; TIMP2; TIMP2_HUMAN; Tissue Inhibitor of Metalloproteinase 2; Tissue inhibitor of metalloproteinases 2
Target Background
This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix.
Notification