-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EGR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-250aa of human EGR1(NP_001955.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against EGR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-250aa of human EGR1(NP_001955.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-15249A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EGR1 |
| Target Synonyms | TIS8; AT225; G0S30; NGFI-A; ZNF225; KROX-24; ZIF-268; EGR1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T+FBS, C2C12+EGF | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 90-250aa of human EGR1(NP_001955.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ADTGEQPYEHLTAESFPDISLNNEKVLVETSYPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAASSASASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAYPAAKGGFQVP | Uniprot ID | P18146 |
Uniprot Id
P18146
Target Species
Human
Target Name
EGR1
Target Full Name
Early growth response protein 1
Target Function
Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-GCG(T/G)GGGCG-3'(EGR-site) in the promoter region of target genes. Binds double-stranded target DNA, irrespective of the cytosine methylation status. Regulates the transcription of numerous target genes, and thereby plays an important role in regulating the response to growth factors, DNA damage, and ischemia. Plays a role in the regulation of cell survival, proliferation and cell death. Activates expression of p53/TP53 and TGFB1, and thereby helps prevent tumor formation. Required for normal progress through mitosis and normal proliferation of hepatocytes after partial hepatectomy. Mediates responses to ischemia and hypoxia; regulates the expression of proteins such as IL1B and CXCL2 that are involved in inflammatory processes and development of tissue damage after ischemia. Regulates biosynthesis of luteinizing hormone (LHB) in the pituitary. Regulates the amplitude of the expression rhythms of clock genes: ARNTL/BMAL1, PER2 and NR1D1 in the liver via the activation of PER1 (clock repressor) transcription. Regulates the rhythmic expression of core-clock gene ARNTL/BMAL1 in the suprachiasmatic nucleus (SCN).
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
EGR C2H2-type zinc-finger protein family
Target Tissue Specificity
Detected in neutrophils (at protein level).
Target Research Area
Transcription
Target Synonyms
AT225; Early growth response 1; Early growth response protein 1; EGR 1; EGR-1; EGR1; EGR1_HUMAN; G0S30; KROX 24; KROX24; Nerve growth factor-induced clone A; Nerve growth factor-induced protein A; NGFI-A; NGFIA; TIS8; Transcription factor ETR103; Transcription factor Zif268; ZIF 268; ZIF268; Zinc finger protein 225; Zinc finger protein Krox-24; ZNF225
Target Background
The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppressor gene.
Notification