-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD3E was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD3E (NP_000724.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, FC, ELISA.
The antibody against CD3E was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD3E (NP_000724.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, FC, ELISA.
| Cat.No | ADA-15825A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD3E |
| Target Synonyms | T3E; TCRE; IMD18; CD3epsilon; CD3E | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat cells | Application | ELISA, WB, FC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD3E (NP_000724.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYS | Uniprot ID | P07766 |
Uniprot Id
P07766
Target Species
Human
Target Name
CD3E
Target Full Name
T-cell surface glycoprotein CD3 epsilon chain
Target Function
Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development. Initiates the TCR-CD3 complex assembly by forming the two heterodimers CD3D/CD3E and CD3G/CD3E. Participates also in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region.
Target Involvement
Immunodeficiency 18 (IMD18)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Research Area
Immunology
Target Synonyms
CD3 epsilon; CD3e; CD3e antigen; CD3e antigen epsilon polypeptide (TiT3 complex); CD3E antigen epsilon polypeptide; CD3E antigen, epsilon subunit; CD3e molecule epsilon; CD3e molecule, epsilon (CD3 TCR complex); CD3e molecule, epsilon (CD3-TCR complex); CD3E_HUMAN; IMD18; T cell antigen receptor complex epsilon subunit of T3; T cell surface antigen T3/Leu 4 epsilon chain; T cell surface glycoprotein CD3 epsilon chain; T-cell surface antigen T3/Leu-4 epsilon chain; T-cell surface glycoprotein CD3 epsilon chain; T3E; TCRE
Target Background
The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.
Notification