Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GDI2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 296-445 of human GDI2 (NP_001485.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against GDI2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 296-445 of human GDI2 (NP_001485.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-15830A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GDI2 |
| Target Synonyms | RABGDIB; HEL-S-46e; I2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, A-549, HepG2, HT-29, Mouse lung, Mouse spleen, Rat liver, Rat spinal cord, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 296-445 of human GDI2 (NP_001485.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED | Uniprot ID | P50395 |
Uniprot Id
P50395
Target Species
Human
Target Name
GDI2
Target Full Name
Rab GDP dissociation inhibitor beta
Target Function
Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.
Target Subcellular Location
Cytoplasm. Membrane; Peripheral membrane protein.
Target Protein Families
Rab GDI family
Target Tissue Specificity
Ubiquitous.
Target Research Area
Signal Transduction
Target Synonyms
GDI-2; GDI2; GDIB_HUMAN; GDP dissociation inhibitor 2; Guanosine diphosphate dissociation inhibitor 2; Rab GDI beta; Rab GDP dissociation inhibitor beta; RABGDIB
Target Background
GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI2 is ubiquitously expressed. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion/deletion rearrangements. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
