-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cytokeratin 7 (KRT7) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 7 (KRT7) (P08729) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Cytokeratin 7 (KRT7) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 7 (KRT7) (P08729) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16080A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cytokeratin 7 (KRT7) |
| Target Synonyms | K7; CK7; SCL; K2C7; Cytokeratin 7 (KRT7) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, A-549, Mouse lung, Rat kidney | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 7 (KRT7) (P08729). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNN | Uniprot ID | P08729 |
Uniprot Id
P08729
Target Species
Human
Target Name
KRT7
Target Full Name
Keratin, type II cytoskeletal 7
Target Function
Blocks interferon-dependent interphase and stimulates DNA synthesis in cells. Involved in the translational regulation of the human papillomavirus type 16 E7 mRNA (HPV16 E7).
Target Subcellular Location
Cytoplasm.
Target Protein Families
Intermediate filament family
Target Tissue Specificity
Expressed in cultured epidermal, bronchial and mesothelial cells but absent in colon, ectocervix and liver. Observed throughout the glandular cells in the junction between stomach and esophagus but is absent in the esophagus.
Target Research Area
Signal Transduction
Target Synonyms
CK 7; CK-7; CK7; Cytokeratin 7; Cytokeratin-7; D15Wsu77e; K2C7; K2C7_HUMAN; K7; Keratin 7; Keratin 7; type II; Keratin type II cytoskeletal 7; Keratin; 55K type II cytoskeletal; Keratin; simple epithelial; Keratin; simple epithelial type I; K7; Keratin; type II cytoskeletal 7; Keratin-7; Krt2-7; KRT7; MGC11625; MGC129731; MGC3625; Sarcolectin; SCL; Type II mesothelial keratin K7; Type-II keratin Kb7
Target Background
The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. Alternative splicing may result in several transcript variants; however, not all variants have been fully described.
Notification