-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Collagen XVII/COL17A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1300-1400 of human Collagen XVII/COL17A1 (Q9UMD9) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Collagen XVII/COL17A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1300-1400 of human Collagen XVII/COL17A1 (Q9UMD9) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16082A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Collagen XVII/COL17A1 |
| Target Synonyms | ERED; JEB4; BP180; BPA-2; BPAG2; LAD-1; BA16H23.2; Collagen XVII/COL17A1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A431 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1300-1400 of human Collagen XVII/COL17A1 (Q9UMD9). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SVRRGSSYSSSMSTGGGGAGSLGAGGAFGEAAGDRGPYGTDIGPGGGYGAAAEGGMYAGNGGLLGADFAGDLDYNELAVRVSESMQRQGLLQGMAYTVQGP | Uniprot ID | Q9UMD9 |
Uniprot Id
Q9UMD9
Target Species
Human
Target Name
COL17A1
Target Full Name
Collagen alpha-1(XVII) chain
Target Function
May play a role in the integrity of hemidesmosome and the attachment of basal keratinocytes to the underlying basement membrane.; The 120 kDa linear IgA disease antigen is an anchoring filament component involved in dermal-epidermal cohesion. Is the target of linear IgA bullous dermatosis autoantibodies.
Target Involvement
Generalized atrophic benign epidermolysis bullosa (GABEB); Epithelial recurrent erosion dystrophy (ERED)
Target Subcellular Location
Cell junction, hemidesmosome. Membrane; Single-pass type II membrane protein. Note=Localized along the plasma membrane of the hemidesmosome.; [120 kDa linear IgA disease antigen]: Secreted, extracellular space, extracellular matrix, basement membrane. Note=Exclusively localized to anchoring filaments. Localized to the epidermal side of split skin.; [97 kDa linear IgA disease antigen]: Secreted, extracellular space, extracellular matrix, basement membrane. Note=Localized in the lamina lucida beneath the hemidesmosomes.
Target Tissue Specificity
Detected in skin. In the cornea, it is detected in the epithelial basement membrane, the epithelial cells, and at a lower level in stromal cells (at protein level). Stratified squamous epithelia. Found in hemidesmosomes. Expressed in cornea, oral mucosa,
Target Research Area
Signal Transduction
Target Synonyms
COL17A1; BP180; BPAG2Collagen alpha-1(XVII) chain; 180 kDa bullous pemphigoid antigen 2; Bullous pemphigoid antigen 2) [Cleaved into: 120 kDa linear IgA disease antigen; 120 kDa linear IgA dermatosis antigen; Linear IgA disease antigen 1; LAD-1); 97 kDa linear IgA disease antigen; 97 kDa linear IgA bullous dermatosis antigen; 97 kDa LAD antigen; 97-LAD; Linear IgA bullous disease antigen of 97 kDa; LABD97)]
Target Background
This gene encodes the alpha chain of type XVII collagen. Unlike most collagens, collagen XVII is a transmembrane protein. Collagen XVII is a structural component of hemidesmosomes, multiprotein complexes at the dermal-epidermal basement membrane zone that mediate adhesion of keratinocytes to the underlying membrane. Mutations in this gene are associated with both generalized atrophic benign and junctional epidermolysis bullosa. Two homotrimeric forms of type XVII collagen exist. The full length form is the transmembrane protein. A soluble form, referred to as either ectodomain or LAD-1, is generated by proteolytic processing of the full length form.
Notification