Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MOV10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800-900 of human MOV10 (Q9HCE1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MOV10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800-900 of human MOV10 (Q9HCE1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16204A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MOV10 |
| Target Synonyms | gb110; fSAP113; MOV10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, HepG2, Mouse liver, Rat kidney, U-87MG, U2OS | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 800-900 of human MOV10 (Q9HCE1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AATVTSYLKLLLAPSSKKGKARLSPRSVGVISPYRKQVEKIRYCITKLDRELRGLDDIKDLKVGSVEEFQGQERSVILISTVRSSQSFVQLDLDFNLGFLK | Uniprot ID | Q9HCE1 |
Uniprot Id
Q9HCE1
Target Species
Human
Target Name
MOV10
Target Full Name
Helicase MOV-10
Target Function
5' to 3' RNA helicase contributing to UPF1 mRNA target degradation by translocation along 3' UTRs. Required for microRNA (miRNA)-mediated gene silencing by the RNA-induced silencing complex (RISC). Required for both miRNA-mediated translational repression and miRNA-mediated cleavage of complementary mRNAs by RISC. In cooperation with FMR1, regulates miRNA-mediated translational repression by AGO2. Restricts retrotransposition of long interspersed element-1 (LINE-1) in cooperation with TUT4 and TUT7 counteracting the RNA chaperonne activity of L1RE1. Facilitates LINE-1 uridylation by TUT4 and TUT7. Required for embryonic viability and for normal central nervous system development and function. Plays two critical roles in early brain development: suppresses retroelements in the nucleus by directly inhibiting cDNA synthesis, while regulates cytoskeletal mRNAs to influence neurite outgrowth in the cytosol. May function as a messenger ribonucleoprotein (mRNP) clearance factor. Exhibits antiviral activity against dengue virus (DENV).; (Microbial infection) Required for RNA-directed transcription and replication of the human hepatitis delta virus (HDV). Interacts with small capped HDV RNAs derived from genomic hairpin structures that mark the initiation sites of RNA-dependent HDV RNA transcription.
Target Subcellular Location
Cytoplasm, P-body. Cytoplasm, Cytoplasmic ribonucleoprotein granule. Cytoplasm, Stress granule. Nucleus. Cytoplasm.
Target Protein Families
DNA2/NAM7 helicase family, SDE3 subfamily
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
MOV10; KIAA1631; Helicase MOV-10; EC 3.6.4.13; Armitage homolog; Moloney leukemia virus 10 protein
Target Background
Enables 5'-3' RNA helicase activity and RNA binding activity. Involved in defense response to virus; negative regulation of transposition, RNA-mediated; and posttranscriptional regulation of gene expression. Located in P-body and cytosol. Implicated in hypertension.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
