-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD47 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 224-323 of human CD47 (Q08722) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD47 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 224-323 of human CD47 (Q08722) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16566A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD47 |
| Target Synonyms | IAP; OA3; MER6; CD47 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-2 OS | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 224-323 of human CD47 (Q08722). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HYYVFSTAIGLTSFVIAILVIQVIAYILAVVGLSLCIAACIPMHGPLLISGLSILALAQLLGLVYMKFVASNQKTIQPPRKAVEEPLNAFKESKGMMNDE | Uniprot ID | Q08722 |
Uniprot Id
Q08722
Target Species
Human
Target Name
CD47
Target Full Name
Leukocyte surface antigen CD47
Target Function
Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus. Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Tissue Specificity
Very broadly distributed on normal adult tissues, as well as ovarian tumors, being especially abundant in some epithelia and the brain.
Target Research Area
Cancer
Target Synonyms
Antigenic surface determinant protein OA3;Integrin-associated protein;IAP;Protein MER6;CD antigen CD47
Target Background
This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene.
Notification