Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BRPF3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human BRPF3 (NP_056510.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BRPF3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human BRPF3 (NP_056510.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00240A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BRPF3 |
| Target Synonyms | BRPF3 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human BRPF3 (NP_056510.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HRISIYDPLKIITEDELTAQDITECNSNKENSEQPQFPGKSKKPSSKGKKKESCSKHASGTSFHLPQPSFRMVDSGIQPEAPPLPAAYYRYIEKPPEDLDA | Uniprot ID | Q9ULD4 |
Uniprot Id
Q9ULD4
Target Species
Human
Target Name
BRPF3
Target Full Name
Bromodomain and PHD finger-containing protein 3
Target Function
Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity. Plays a role in DNA replication initiation by directing KAT7/HBO1 specificity towards histone H3 'Lys-14' acetylation (H3K14ac), thereby facilitating the activation of replication origins. Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity.
Target Subcellular Location
Nucleus.
Target Synonyms
BRPF3; KIAA1286Bromodomain and PHD finger-containing protein 3
Target Background
Predicted to enable histone binding activity. Involved in histone H3-K14 acetylation and positive regulation of DNA replication. Part of MOZ/MORF histone acetyltransferase complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
