Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cyclin B2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Cyclin B2 (NP_004692.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Cyclin B2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Cyclin B2 (NP_004692.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00271A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cyclin B2 |
| Target Synonyms | HsT17299; Cyclin B2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-431, SW480 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Cyclin B2 (NP_004692.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSM | Uniprot ID | O95067 |
Uniprot Id
O95067
Target Species
Human
Target Name
CCNB2
Target Full Name
G2/mitotic-specific cyclin-B2
Target Function
Essential for the control of the cell cycle at the G2/M (mitosis) transition.
Target Protein Families
Cyclin family, Cyclin AB subfamily
Target Synonyms
ccnb2; CCNB2_HUMAN; CycB2; Cyclin B2; G2 mitotic specific cyclin B2; G2/mitotic specific cyclin B2; G2/mitotic-specific cyclin-B2; HsT17299; MGC108931; MGC140694
Target Background
Cyclin B2 is a member of the cyclin family, specifically the B-type cyclins. The B-type cyclins, B1 and B2, associate with p34cdc2 and are essential components of the cell cycle regulatory machinery. B1 and B2 differ in their subcellular localization. Cyclin B1 co-localizes with microtubules, whereas cyclin B2 is primarily associated with the Golgi region. Cyclin B2 also binds to transforming growth factor beta RII and thus cyclin B2/cdc2 may play a key role in transforming growth factor beta-mediated cell cycle control.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
