Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RXFP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 305-374 of human RXFP4 (NP_871001.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RXFP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 305-374 of human RXFP4 (NP_871001.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00568A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RXFP4 |
| Target Synonyms | GPR100; RLN3R2; RXFPR4; GPCR142; RXFP4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 305-374 of human RXFP4 (NP_871001.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NPVLYCLLRREPRQALAGTFRDLRLRLWPQGGGWVQQVALKQVGRRWVASNPRESRPSTLLTNLDRGTPG | Uniprot ID | Q8TDU9 |
Uniprot Id
Q8TDU9
Target Species
Human
Target Name
RXFP4
Target Full Name
Relaxin-3 receptor 2
Target Function
High affinity receptor for INSL5. Also acts as receptor for RLN3/relaxin-3, as well as bradykinin and kallidin. Binding of the ligand inhibit cAMP accumulation.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Expressed in a broader range of tissues including brain, kidney, testis, thymus, placenta, prostate, salivary gland, thyroid and colon.
Target Synonyms
RXFP4; GPCR142; GPR100; RLN3R2; Relaxin-3 receptor 2; RLN3 receptor 2; G-protein coupled receptor 100; G-protein coupled receptor GPCR142; Insulin-like peptide INSL5 receptor; Relaxin family peptide receptor 4
Target Background
GPR100 is a member of the rhodopsin family of G protein-coupled receptors (GPRs) (Fredriksson et al., 2003 [PubMed 14623098]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
