Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ITIH3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 35-180 of human ITIH3 (NP_002208.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ITIH3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 35-180 of human ITIH3 (NP_002208.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00986A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ITIH3 |
| Target Synonyms | H3P; SHAP; ITI-HC3; ITIH3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HepG2, Mouse liver, Mouse lung, NCI-H460, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 35-180 of human ITIH3 (NP_002208.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LPEGVANGIEVYSTKINSKVTSRFAHNVVTMRAVNRADTAKEVSFDVELPKTAFITNFTLTIDGVTYPGNVKEKEVAKKQYEKAVSQGKTAGLVKASGRKLEKFTVSVNVAAGSKVTFELTYEELLKRHKGKYEMYLKVQPKQLVK | Uniprot ID | Q06033 |
Uniprot Id
Q06033
Target Species
Human
Target Name
ITIH3
Target Full Name
Inter-alpha-trypsin inhibitor heavy chain H3
Target Function
May act as a carrier of hyaluronan in serum or as a binding protein between hyaluronan and other matrix protein, including those on cell surfaces in tissues to regulate the localization, synthesis and degradation of hyaluronan which are essential to cells undergoing biological processes.
Target Subcellular Location
Secreted.
Target Protein Families
ITIH family
Target Research Area
Others
Target Synonyms
(ITI heavy chain H3)(ITI-HC3)(Inter-alpha-inhibitor heavy chain 3)(Serum-derived hyaluronan-associated protein)(SHAP)
Target Background
This gene encodes the heavy chain subunit of the pre-alpha-trypsin inhibitor complex. This complex may stabilize the extracellular matrix through its ability to bind hyaluronic acid. Polymorphisms of this gene may be associated with increased risk for schizophrenia and major depressive disorder. This gene is present in an inter-alpha-trypsin inhibitor family gene cluster on chromosome 3.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
