Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ROGDI was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ROGDI (NP_078865.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ROGDI was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ROGDI (NP_078865.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01019A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ROGDI |
| Target Synonyms | KTZS; RAV2; ROGD1; ROGDI | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ROGDI (NP_078865.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATVMAATAAERAVLEEEFRWLLHDEVHAVLKQLQDILKEASLRFTLPGSGTEGPAKQENFILGSCGTDQVKGVLTLQGDALSQADVNLKMPRNNQLLHFAFREDKQWKLQQIQDARNHVSQAIYLLTSRDQSYQFKTGA | Uniprot ID | Q9GZN7 |
Uniprot Id
Q9GZN7
Target Species
Human
Target Name
ROGDI
Target Full Name
Protein rogdi homolog
Target Involvement
Kohlschuetter-Toenz syndrome (KTZS)
Target Subcellular Location
Nucleus envelope. Cell junction, synapse, presynapse. Cell projection, axon. Perikaryon. Cell projection, dendrite. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle.
Target Protein Families
Rogdi family
Target Tissue Specificity
Widely expressed with highest levels in spinal cord, brain, heart and bone marrow. Also expressed in fetal brain and liver.
Target Synonyms
FLJ22386; KTZS; Leucine zipper domain protein; Protein rogdi homolog; rogdi; rogdi homolog (Drosophila); rogdi, Drosophila, homolog of; ROGDI_HUMAN
Target Background
Involved in brain development; neurogenesis; and odontogenesis of dentin-containing tooth. Located in nuclear envelope. Implicated in Kohlschutter-Tonz syndrome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
