Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SULF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 726-870 of human SULF2 (NP_061325.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SULF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 726-870 of human SULF2 (NP_061325.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01103A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SULF2 |
| Target Synonyms | HSULF-2; SULF2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 726-870 of human SULF2 (NP_061325.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TCFTHDNQHWQTAPFWTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYEQYRQFQRRKWPEMKRPSSKSLGQLWEGWEG | Uniprot ID | Q8IWU5 |
Uniprot Id
Q8IWU5
Target Species
Human
Target Name
SULF2
Target Full Name
Extracellular sulfatase Sulf-2
Target Function
Exhibits arylsulfatase activity and highly specific endoglucosamine-6-sulfatase activity. It can remove sulfate from the C-6 position of glucosamine within specific subregions of intact heparin.
Target Subcellular Location
Endoplasmic reticulum. Golgi apparatus, Golgi stack. Cell surface.
Target Protein Families
Sulfatase family
Target Tissue Specificity
Expressed at highest levels in the ovary, skeletal muscle, stomach, brain, uterus, heart, kidney and placenta.
Target Synonyms
Extracellular sulfatase Sulf 2; Extracellular sulfatase Sulf-2; HSulf-2; HSulf2; Sulf2; SULF2_HUMAN
Target Background
Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF2, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules (Dai et al., 2005 [PubMed 16192265]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
