-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DDX50 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human DDX50 (NP_076950.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against DDX50 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human DDX50 (NP_076950.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-01144A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DDX50 |
| Target Synonyms | GU2; GUB; mcdrh; RH-II/GuB; DDX50 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, HepG2, Jurkat | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human DDX50 (NP_076950.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPGKLLWGDIMELEAPLEESESQKKERQKSDRRKSRHHYDSDEKSETRENGVTDDLDAPKAKKSKMKEKLNGDTEEGFNRLSDEFSKSHKSRRKDLPNGDIDEYEKKSKRVSSLDTSTHKSSDNKLEETLTREQK | Uniprot ID | Q9BQ39 |
Uniprot Id
Q9BQ39
Target Species
Human
Target Name
DDX50
Target Full Name
ATP-dependent RNA helicase DDX50
Target Subcellular Location
Nucleus, nucleolus.
Target Protein Families
DEAD box helicase family, DDX21/DDX50 subfamily
Target Synonyms
4933429B04Rik; ATP-dependent RNA helicase DDX50; Ddx50; DDX50_HUMAN; DEAD (Asp-Glu-Ala-Asp) box polypeptide 50; DEAD box protein 50; Gu beta; Gu-beta; GU2; GUB; MGC109605; MGC3199; Nucleolar protein Gu2; RH II; RH II/GuB; RNA helicase II / Gu beta
Target Background
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box enzyme that may be involved in ribosomal RNA synthesis or processing. This gene and DDX21, also called RH-II/GuA, have similar genomic structures and are in tandem orientation on chromosome 10, suggesting that the two genes arose by gene duplication in evolution. This gene has pseudogenes on chromosomes 2, 3 and 4. Alternative splicing of this gene generates multiple transcript variants, but the full length nature of all the other variants but one has not been defined.
Notification