-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYL6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-151 of human MYL6 (NP_066299.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MYL6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-151 of human MYL6 (NP_066299.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01186A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYL6 |
| Target Synonyms | LC17; ESMLC; LC17A; LC17B; MLC-3; MLC1SM; MLC3NM; MLC3SM; LC17-GI; LC17-NM; MYL6 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-151 of human MYL6 (NP_066299.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG | Uniprot ID | P60660 |
Uniprot Id
P60660
Target Species
Human
Target Name
MYL6
Target Full Name
Myosin light polypeptide 6
Target Function
Regulatory light chain of myosin. Does not bind calcium.
Target Research Area
Signal Transduction
Target Synonyms
17 kDa myosin light chain; ESMLC; LC 17; LC17; LC17 GI; LC17 NM; LC17A; LC17B; MLC 3; MLC-3; MLC1SM; MLC3; MLC3NM; MLC3SM; MYL 6; MYL6; MYL6_HUMAN; Myosin light chain 3; Myosin light chain 6 alkali smooth muscle and non muscle; Myosin light chain A3; Myosin light chain alkali 3; Myosin light polypeptide 6 alkali smooth muscle and non muscle; Myosin light polypeptide 6; Smooth muscle and non muscle myosin alkali light chain; Smooth muscle and nonmuscle myosin light chain alkali 6
Target Background
Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene.
Notification