Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GYG1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 234-333 of human GYG1 (NP_001171649.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GYG1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 234-333 of human GYG1 (NP_001171649.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01339A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GYG1 |
| Target Synonyms | GYG; GSD15; GYG1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat heart, MCF7, Mouse liver, Mouse skeletal muscle, SW480 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 234-333 of human GYG1 (NP_001171649.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EAHDPNMTHPEFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ | Uniprot ID | P46976 |
Uniprot Id
P46976
Target Species
Human
Target Name
GYG1
Target Full Name
Glycogenin-1
Target Function
Self-glucosylates, via an inter-subunit mechanism, to form an oligosaccharide primer that serves as substrate for glycogen synthase.
Target Involvement
Glycogen storage disease 15 (GSD15); Polyglucosan body myopathy 2 (PGBM2)
Target Protein Families
Glycosyltransferase 8 family, Glycogenin subfamily
Target Tissue Specificity
Highly expressed in skeletal muscle and heart, with lower levels in brain, lung, kidney and pancreas.
Target Synonyms
Glycogenin; Glycogenin-1; Glycogenin1; GLYG_HUMAN; GN-1; GN1; GYG 1; GYG; GYG1
Target Background
This gene encodes a member of the glycogenin family. Glycogenin is a glycosyltransferase that catalyzes the formation of a short glucose polymer from uridine diphosphate glucose in an autoglucosylation reaction. This reaction is followed by elongation and branching of the polymer, catalyzed by glycogen synthase and branching enzyme, to form glycogen. This gene is expressed in muscle and other tissues. Mutations in this gene result in glycogen storage disease XV. This gene has pseudogenes on chromosomes 1, 8 and 13 respectively. Alternatively spliced transcript variants encoding different isoforms have been identified.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
