Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DACT3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human DACT3 (NP_659493.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DACT3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human DACT3 (NP_659493.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of various lysates, using DACT3 Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
| Cat.No | ADA-01543A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DACT3 |
| Target Synonyms | RRR1; DAPPER3; DACT3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293F | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human DACT3 (NP_659493.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MIRAFSFPVSPERGRLRGWLEGSLAGLCELHWLRERQEYRVQQALRLAQPGMGGAEAEDEEDADEDEDAAAARRAAAALEEQLEALPGLVWDLGQQLGDLSLESGGLEQESGRSSGFYEDPSSTGGPDSPPSTFCGDSGFSGSSSYGRLGPSEPRGIYAS | Uniprot ID | Q96B18 |
Uniprot Id
Q96B18
Target Species
Human
Target Name
DACT3
Target Full Name
Dapper homolog 3
Target Function
May be involved in regulation of intracellular signaling pathways during development. Specifically thought to play a role in canonical and/or non-canonical Wnt signaling pathways through interaction with DSH (Dishevelled) family proteins.
Target Protein Families
Dapper family
Target Synonyms
Antagonist of beta-catenin Dapper homolog 3; Arginine rich region 1 ; Arginine rich region 1 protein; Arginine-rich region 1 protein; Dact3; DACT3_HUMAN; Dapper antagonist of beta catenin 3; Dapper antagonist of beta catenin homolog 3 (Xenopus laevis); Dapper homolog 3; Dapper3; Dpr3; RRR1; Thymus expressed gene 3 like
Target Background
Predicted to enable delta-catenin binding activity; protein kinase A binding activity; and protein kinase C binding activity. Involved in negative regulation of canonical Wnt signaling pathway and negative regulation of cell growth. Predicted to be active in cytoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
