-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against p53 DINP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human p53 DINP1 (NP_001129205.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against p53 DINP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human p53 DINP1 (NP_001129205.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01546A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | p53 DINP1 |
| Target Synonyms | SIP; Teap; p53DINP1; TP53DINP1; TP53INP1A; TP53INP1B; p53 DINP1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human p53 DINP1 (NP_001129205.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MFQRLNKMFVGEVSSSSNQEPEFNEKEDDEWILVDFIDTCTGFSAEEEEEEEDISEESPTEHPSVFSCLPASLECLADTSDSCFLQFESCPMEESWFITP | Uniprot ID | Q96A56 |
Uniprot Id
Q96A56
Target Species
Human
Target Name
TP53INP1
Target Full Name
Tumor protein p53-inducible nuclear protein 1
Target Function
Antiproliferative and proapoptotic protein involved in cell stress response which acts as a dual regulator of transcription and autophagy. Acts as a positive regulator of autophagy. In response to cellular stress or activation of autophagy, relocates to autophagosomes where it interacts with autophagosome-associated proteins GABARAP, GABARAPL1/L2, MAP1LC3A/B/C and regulates autophagy. Acts as an antioxidant and plays a major role in p53/TP53-driven oxidative stress response. Possesses both a p53/TP53-independent intracellular reactive oxygen species (ROS) regulatory function and a p53/TP53-dependent transcription regulatory function. Positively regulates p53/TP53 and p73/TP73 and stimulates their capacity to induce apoptosis and regulate cell cycle. In response to double-strand DNA breaks, promotes p53/TP53 phosphorylation on 'Ser-46' and subsequent apoptosis. Acts as a tumor suppressor by inducing cell death by an autophagy and caspase-dependent mechanism. Can reduce cell migration by regulating the expression of SPARC.
Target Subcellular Location
Cytoplasm, cytosol. Nucleus. Nucleus, PML body. Cytoplasmic vesicle, autophagosome. Note=Shuttles between the nucleus and the cytoplasm, depending on cellular stress conditions, and re-localizes to autophagosomes on autophagy activation.
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
DKFZp434M1317; FLJ22139; p53 damage inducible nuclear protein 1; p53 dependent damage inducible nuclear protein 1; p53 inducible nuclear protein 1; p53 inducible p53DINP1; p53-dependent damage-inducible nuclear protein 1; p53DINP1; SIP; Stress induced protein; Stress-induced protein; T53I1_HUMAN; Teap; TP53 DINP1; TP53 INP1; TP53DINP1; TP53INP1; TP53INP1A; TP53INP1B; Tumor protein p53 inducible nuclear protein 1; Tumor protein p53-inducible nuclear protein 1
Target Background
Predicted to enable antioxidant activity. Involved in autophagic cell death; positive regulation of autophagy; and positive regulation of transcription, DNA-templated. Located in autophagosome; cytosol; and nucleus.
Notification