-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBE2K was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBE2K (NP_005330.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UBE2K was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBE2K (NP_005330.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01712A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBE2K |
| Target Synonyms | LIG; HIP2; HYPG; UBC1; E2-25K; UBE2K | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1, HL-60, MCF7, Raji, SKOV3, SW480, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBE2K (NP_005330.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQW | Uniprot ID | P61086 |
Uniprot Id
P61086
Target Species
Human
Target Name
UBE2K
Target Full Name
Ubiquitin-conjugating enzyme E2 K
Target Function
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, in the presence or in the absence of BRCA1-BARD1 E3 ubiquitin-protein ligase complex, catalyzes the synthesis of 'Lys-48'-linked polyubiquitin chains. Does not transfer ubiquitin directly to but elongates monoubiquitinated substrate protein. Mediates the selective degradation of short-lived and abnormal proteins, such as the endoplasmic reticulum-associated degradation (ERAD) of misfolded lumenal proteins. Ubiquitinates huntingtin. May mediate foam cell formation by the suppression of apoptosis of lipid-bearing macrophages through ubiquitination and subsequence degradation of p53/TP53. Proposed to be involved in ubiquitination and proteolytic processing of NF-kappa-B; in vitro supports ubiquitination of NFKB1. In case of infection by cytomegaloviruses may be involved in the US11-dependent degradation of MHC class I heavy chains following their export from the ER to the cytosol. In case of viral infections may be involved in the HPV E7 protein-dependent degradation of RB1.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Ubiquitin-conjugating enzyme family
Target Tissue Specificity
Expressed in all tissues tested, including spleen, thymus, prostate, testis, ovary, small intestine, colon, peripheral blood leukocytes, T-lymphocytes, monocytes, granulocytes and bone marrow mononuclear cells. Highly expressed in brain, with highest leve
Target Research Area
Neuroscience
Target Synonyms
E2 25K; E2(25K); HIP-2; Huntingtin interacting protein 2; Huntingtin-interacting protein 2; HYPG; LIG; UBC1; UBE2K; UBE2K_HUMAN; Ubiquitin carrier protein; Ubiquitin conjugating enzyme E2 25 kDa; ubiquitin conjugating enzyme E2K; ubiquitin conjugating enzyme E2K (UBC1 homolog, yeast); Ubiquitin protein ligase; Ubiquitin-conjugating enzyme E2 K; Ubiquitin-conjugating enzyme E2(25K); Ubiquitin-conjugating enzyme E2-25 kDa; Ubiquitin-conjugating enzyme E2-25K; Ubiquitin-protein ligase
Target Background
The protein encoded by this gene belongs to the ubiquitin-conjugating enzyme family. This protein interacts with RING finger proteins, and it can ubiquitinate huntingtin, the gene product for Huntington's disease. Known functions for this protein include a role in aggregate formation of expanded polyglutamine proteins and the suppression of apoptosis in polyglutamine diseases, a role in the dislocation of newly synthesized MHC class I heavy chains from the endoplasmic reticulum, and involvement in foam cell formation. Multiple transcript variants encoding different isoforms have been identified for this gene.
Notification