Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TIAF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human TIAF1 (NP_004731.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TIAF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human TIAF1 (NP_004731.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01959A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TIAF1 |
| Target Synonyms | TIAF1; MAJN; SPR210 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse liver, PC-3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human TIAF1 (NP_004731.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG | Uniprot ID | O95411 |
Uniprot Id
O95411
Target Species
Human
Target Name
MYO18A
Target Full Name
Putative TGFB1-induced anti-apoptotic factor 1
Target Function
Inhibits the cytotoxic effects of TNF-alpha and overexpressed TNF receptor adapters TRADD, FADD, and RIPK1. Involved in TGF-beta1 inhibition of IkappaB-alpha expression and suppression of TNF-mediated IkappaB-alpha degradation.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Not detectable in normal kidney and liver. Up-regulated in chronic and acute allograft rejection: expressed in the inflammatory infiltrate and in tubular epithelial cells.
Target Research Area
Cell Biology
Target Synonyms
TIAF1; TGFB1-induced anti-apoptotic factor 1; 12 kDa TGF-beta-1-induced antiapoptotic factor
Target Background
Inhibits the cytotoxic effects of TNF-alpha and overexpressed TNF receptor adapters TRADD, FADD, and RIPK1. Involved in TGF-beta1 inhibition of IkappaB-alpha expression and suppression of TNF-mediated IkappaB-alpha degradation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
