Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ST8SIA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-160 of human ST8SIA2 (NP_006002.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ST8SIA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-160 of human ST8SIA2 (NP_006002.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01967A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ST8SIA2 |
| Target Synonyms | STX; SIAT8B; SIAT8-B; HsT19690; ST8SiaII; ST8SIA-II; ST8SIA2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, Rat heart, Mouse brain, Mouse lung, Mouse testis, SKOV3, THP-1 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 24-160 of human ST8SIA2 (NP_006002.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFGTCAIV | Uniprot ID | Q92186 |
Uniprot Id
Q92186
Target Species
Human
Target Name
ST8SIA2
Target Full Name
Alpha-2,8-sialyltransferase 8B
Target Function
May transfer sialic acid through alpha-2,8-linkages to the alpha-2,3-linked and alpha-2,6-linked sialic acid of N-linked oligosaccharides of glycoproteins and may be involved in PSA (polysialic acid) expression.
Target Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.
Target Protein Families
Glycosyltransferase 29 family
Target Tissue Specificity
Highly expressed in fetal brain, kidney and heart and to a much lesser extent in adult heart and thymus.
Target Synonyms
ST8SIA2; SIAT8B; STX; Alpha-2,8-sialyltransferase 8B; EC 2.4.99.-; Sialyltransferase 8B; SIAT8-B; Sialyltransferase St8Sia II; ST8SiaII; Sialyltransferase X; STX
Target Background
The protein encoded by this gene is a type II membrane protein that is thought to catalyze the transfer of sialic acid from CMP-sialic acid to N-linked oligosaccharides and glycoproteins. The encoded protein may be found in the Golgi apparatus and may be involved in the production of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). This protein is a member of glycosyltransferase family 29.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
