Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MAML2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 750-850 of human MAML2 (NP_115803.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MAML2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 750-850 of human MAML2 (NP_115803.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02093A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MAML2 |
| Target Synonyms | MAM2; MAM3; MAM-3; MLL-MAML2; MAML2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549, Mouse brain, Mouse lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 750-850 of human MAML2 (NP_115803.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NQQLMGKKQTLQRQIMEQKQQLLLQQQMLADAEKIAPQDQINRHLSRPPPDYKDQRRNVGNMQPTAQYSGGSSTISLNSNQALANPVSTHTILTPNSSLLS | Uniprot ID | Q8IZL2 |
Uniprot Id
Q8IZL2
Target Species
Human
Target Name
MAML2
Target Full Name
Mastermind-like protein 2
Target Function
Acts as a transcriptional coactivator for NOTCH proteins. Has been shown to amplify NOTCH-induced transcription of HES1. Potentiates activation by NOTCH3 and NOTCH4 more efficiently than MAML1 or MAML3.
Target Involvement
A chromosomal aberration involving MAML2 is found in mucoepidermoid carcinomas, benign Warthin tumors and clear cell hidradenomas. Translocation t(11;19)(q21;p13) with CRTC1. The fusion protein consists of the N-terminus of CRTC1 joined to the C-terminus of MAML2. The reciprocal fusion protein consisting of the N-terminus of MAML2 joined to the C-terminus of CRTC1 has been detected in a small number of mucoepidermoid carcinomas.
Target Subcellular Location
Nucleus speckle. Note=Nuclear, in a punctate manner.
Target Protein Families
Mastermind family
Target Tissue Specificity
Widely expressed with high levels detected in placenta, salivary gland and skeletal muscle.
Target Synonyms
KIAA1819; Mam 2 ; Mam-2; MAML2; MAML2_HUMAN; Mastermind-like protein 2
Target Background
The protein encoded by this gene is a member of the Mastermind-like family of proteins. All family members are proline and glutamine-rich, and contain a conserved basic domain that binds the ankyrin repeat domain of the intracellular domain of the Notch receptors (ICN1-4) in their N-terminus, and a transcriptional activation domain in their C-terminus. This protein binds to an extended groove that is formed by the interaction of CBF1, Suppressor of Hairless, LAG-1 (CSL) with ICN, and positively regulates Notch signaling. High levels of expression of this gene have been observed in several B cell-derived lymphomas. Translocations resulting in fusion proteins with both CRTC1 and CRTC3 have been implicated in the development of mucoepidermoid carcinomas, while a translocation event with CXCR4 has been linked with chronic lymphocytic leukemia (CLL). Copy number variation in the polyglutamine tract has been observed.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
