Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CHD9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 85-190 of human CHD9 (NP_079410.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CHD9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 85-190 of human CHD9 (NP_079410.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02201A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CHD9 |
| Target Synonyms | AD013; CHD-9; CReMM; KISH2; PRIC320; CHD9 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, 293T, A-549, Jurkat, K-562, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 85-190 of human CHD9 (NP_079410.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SFGSPAEHVLSPHSQFNCSPIHPQNQPNGLFPDVSDGSPMWGHQTATTISNQNGSPFHQQGHSHSMHQNKSFVAHHDFALFQANEQQTQCTSLRSQQNRNNLNPGQ | Uniprot ID | Q3L8U1 |
Uniprot Id
Q3L8U1
Target Species
Human
Target Name
CHD9
Target Full Name
Chromodomain-helicase-DNA-binding protein 9
Target Function
Acts as a transcriptional coactivator for PPARA and possibly other nuclear receptors. Proposed to be a ATP-dependent chromatin remodeling protein. Has DNA-dependent ATPase activity and binds to A/T-rich DNA. Associates with A/T-rich regulatory regions in promoters of genes that participate in the differentiation of progenitors during osteogenesis.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
SNF2/RAD54 helicase family
Target Tissue Specificity
Widely expressed at low levels. In bone marrow, expression is restricted to osteoprogenitor cells adjacent to mature osteoblasts.
Target Synonyms
CHD9; KIAA0308; KISH2; PRIC320; AD-013; x0008Chromodomain-helicase-DNA-binding protein 9; CHD-9; EC 3.6.4.12; ATP-dependent helicase CHD9; Chromatin-related mesenchymal modulator; CReMM; Chromatin-remodeling factor CHROM1; Kismet homolog 2; PPAR-alpha-interacting complex protein 320 kDa; Peroxisomal proliferator-activated receptor A-interacting complex 320 kDa protein
Target Background
Predicted to enable ATP binding activity; ATP-dependent activity, acting on DNA; and DNA binding activity. Predicted to be involved in DNA duplex unwinding and chromatin organization. Located in cytosol and nucleoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
