Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SNRPF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human SNRPF (NP_003086.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SNRPF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human SNRPF (NP_003086.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-02212A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SNRPF |
| Target Synonyms | SMF; Sm-F; snRNP-F; SNRPF | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, HT-29, LO2, Mouse brain, Mouse testis, SGC-7901 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human SNRPF (NP_003086.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE | Uniprot ID | P62306 |
Uniprot Id
P62306
Target Species
Human
Target Name
SNRPF
Target Full Name
Small nuclear ribonucleoprotein F
Target Function
Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. As part of the U7 snRNP it is involved in histone 3'-end processing.
Target Subcellular Location
Cytoplasm, cytosol. Nucleus.
Target Protein Families
SnRNP Sm proteins family, SmF/LSm6 subfamily
Target Synonyms
SNRPF; PBSCFSmall nuclear ribonucleoprotein F; snRNP-F; Sm protein F; Sm-F; SmF
Target Background
Enables RNA binding activity. Involved in spliceosomal snRNP assembly. Located in cytosol and nucleus. Part of several cellular components, including methylosome; nucleus; and pICln-Sm protein complex. Biomarker of nasopharynx carcinoma.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
