Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PCSK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-170 of human PCSK1 (NP_000430.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PCSK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-170 of human PCSK1 (NP_000430.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02262A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Pcsk1 |
| Target Synonyms | PC1; PC3; NEC1; SPC3; PC1/3; BMIQ12; PCSK1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 28-170 of human PCSK1 (NP_000430.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KRQFVNEWAAEIPGGPEAASAIAEELGYDLLGQIGSLENHYLFKHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERSKRSALRDSALNLFNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGL | Uniprot ID | P29120 |
Uniprot Id
P29120
Target Species
Human
Target Name
PCSK1
Target Full Name
Neuroendocrine convertase 1
Target Function
Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Substrates include POMC, renin, enkephalin, dynorphin, somatostatin, insulin and AGRP.
Target Involvement
Proprotein convertase 1 deficiency (PC1 deficiency)
Target Subcellular Location
Cytoplasmic vesicle, secretory vesicle. Note=Localized in the secretion granules.
Target Protein Families
Peptidase S8 family, Furin subfamily
Target Synonyms
BDP; NEC 1; NEC1; NEC1_HUMAN; Neuroendocrine convertase 1; PC1; PC3; PCSK1; Prohormone convertase 1; Prohormone convertase 1/3; Prohormone convertase 3; Proprotein convertase 1; SPC3
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
