Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SBF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1630-1770 of human SBF1 (NP_002963.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SBF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1630-1770 of human SBF1 (NP_002963.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02320A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SBF1 |
| Target Synonyms | MTMR5; CMT4B3; DENND7A; SBF1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Jurkat, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1630-1770 of human SBF1 (NP_002963.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PPYDWELAQGPPEPPEEERSDGGAPQSRRRVVWPCYDSCPRAQPDAISRLLEELQRLETELGQPAERWKDTWDRVKAAQRLEGRPDGRGTPSSLLVSTAPHHRRSLGVYLQEGPVGSTLSLSLDSDQSSGSTTSGSRQAAR | Uniprot ID | O95248 |
Uniprot Id
O95248
Target Species
Human
Target Name
SBF1
Target Full Name
Myotubularin-related protein 5
Target Function
Acts as an adapter for the phosphatase MTMR2 to regulate MTMR2 catalytic activity and subcellular location. May function as a guanine nucleotide exchange factor (GEF) activating RAB28. Promotes the exchange of GDP to GTP, converting inactive GDP-bound Rab proteins into their active GTP-bound form. Inhibits myoblast differentiation in vitro and induces oncogenic transformation in fibroblasts.
Target Involvement
Charcot-Marie-Tooth disease 4B3 (CMT4B3)
Target Subcellular Location
Cytoplasm. Cytoplasm, perinuclear region.
Target Protein Families
Protein-tyrosine phosphatase family, Non-receptor class myotubularin subfamily
Target Synonyms
SBF1; MTMR5; Myotubularin-related protein 5; Inactive phosphatidylinositol 3-phosphatase 5; SET-binding factor 1; Sbf1
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
