Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SCN2B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-160 of human SCN2B (NP_004579.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SCN2B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-160 of human SCN2B (NP_004579.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02364A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SCN2B |
| Target Synonyms | ATFB14; SCN2B | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, SW620 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-160 of human SCN2B (NP_004579.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAV | Uniprot ID | O60939 |
Uniprot Id
O60939
Target Species
Human
Target Name
SCN2B
Target Full Name
Sodium channel regulatory subunit beta-2
Target Function
Crucial in the assembly, expression, and functional modulation of the heterotrimeric complex of the sodium channel. The subunit beta-2 causes an increase in the plasma membrane surface area and in its folding into microvilli. Interacts with TNR may play a crucial role in clustering and regulation of activity of sodium channels at nodes of Ranvier.
Target Involvement
Atrial fibrillation, familial, 14 (ATFB14)
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Sodium channel auxiliary subunit SCN2B (TC 8.A.17) family
Target Tissue Specificity
Brain specific.
Target Synonyms
SCN2B; UNQ326/PRO386; Sodium channel subunit beta-2
Target Background
The protein encoded by this gene is the beta 2 subunit of the type II voltage-gated sodium channel. The encoded protein is involved in cell-cell adhesion and cell migration. Defects in this gene can be a cause of Brugada Syndrome, atrial fibrillation, or sudden infant death syndrome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
