Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ZBTB25 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 266-435 of human ZBTB25 (NP_008908.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ZBTB25 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 266-435 of human ZBTB25 (NP_008908.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02463A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ZBTB25 |
| Target Synonyms | KUP; ZNF46; C14orf51; ZBTB25 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, MCF7, Mouse brain, Mouse testis, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 266-435 of human ZBTB25 (NP_008908.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PFGVPASILESNDLGEVHPLNENSEALECRRLSSFIVKENEQQPDHTNRGTTEPLQISQVSLISKDTEPVELNCNFSFSRKRKMSCTICGHKFPRKSQLLEHMYTHKGKSYRYNRCQRFGNALAQRFQPYCDSWSDVSLKSSRLSQEHLDLPCALESELTQENVDTILVE | Uniprot ID | P24278 |
Uniprot Id
P24278
Target Species
Human
Target Name
ZBTB25
Target Full Name
Zinc finger and BTB domain-containing protein 25
Target Function
May be involved in transcriptional regulation.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed mainly in hematopoietic cells and testis.
Target Synonyms
ZBT25_HUMAN; ZBTB25; Zinc finger and BTB domain-containing protein 25; Zinc finger protein 46; Zinc finger protein KUP
Target Background
Predicted to enable DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Located in nucleoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
