Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BRCC2/BLID was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human BRCC2/BLID (NP_001001786.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against BRCC2/BLID was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human BRCC2/BLID (NP_001001786.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02598A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BRCC2/BLID |
| Target Synonyms | BRCC2; BRCC2/BLID | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T transfected with BRCC2/BLID | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human BRCC2/BLID (NP_001001786.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL | Uniprot ID | Q8IZY5 |
Uniprot Id
Q8IZY5
Target Species
Human
Target Name
BLID
Target Full Name
BH3-like motif-containing cell death inducer
Target Function
Functions as a proapoptotic molecule through the caspase-dependent mitochondrial pathway of cell death.
Target Subcellular Location
Cytoplasm. Mitochondrion. Note=Lower abundance in mitochondrion than in cytoplasm.
Target Tissue Specificity
Ubiquitously expressed.
Target Research Area
Cell Biology
Target Synonyms
BH3-like motif containing; cell death inducer; BH3-like motif-containing cell death inducer; BLID; BLID_HUMAN; BRCC2; breast cancer cell 2; Breast cancer cell protein 2
Target Background
This gene encodes a BH3-like motif containing protein involved in cell death. The encoded protein may induce apoptosis in a caspase-dependent manner. The protein is localized in both the cytoplasm and the mitochondrion.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
