-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BAP31 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 127-246 of human BAP31 (NP_001243376.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against BAP31 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 127-246 of human BAP31 (NP_001243376.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-02713A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BAP31 |
| Target Synonyms | CDM; DDCH; BAP31; 6C6-AG; DELXQ28; DXS1357E; MICRODELXq28 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Rat brain, A-431, HT-29, MCF-7, Mouse liver, Mouse lung, SH-SY5Y | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 127-246 of human BAP31 (NP_001243376.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE | Uniprot ID | P51572 |
Uniprot Id
P51572
Target Species
Human
Target Name
BCAP31
Target Full Name
B-cell receptor-associated protein 31
Target Function
Functions as a chaperone protein. Is one of the most abundant endoplasmic reticulum (ER) proteins. Plays a role in the export of secreted proteins in the ER, the recognition of abnormally folded protein and their targeting to the ER associated-degradation (ERAD). Also serves as a cargo receptor for the export of transmembrane proteins. Plays a role in the assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) by stimulating the translocation of NDUFS4 and NDUFB11 from the cytosol to the mitochondria via interaction with TOMM40. In response to ER stress, delocalizes from the ER-mitochondria contact sites and binds BCL2. May be involved in CASP8-mediated apoptosis.
Target Involvement
Deafness, dystonia, and cerebral hypomyelination (DDCH)
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein.
Target Protein Families
BCAP29/BCAP31 family
Target Tissue Specificity
Ubiquitous. Highly expressed in neurons and discrete endocrine cells.
Target Research Area
Apoptosis
Target Synonyms
6C6 AG; 6C6 AG tumor associated antigen; 6C6-AG tumor-associated antigen; 6C6AG; 6C6AG tumor associated antigen; Accessory protein BAP 31; Accessory protein BAP31; B cell receptor associated protein 31; B-cell receptor-associated protein 31; BA31; BAP 31; Bap31; BAP31_HUMAN; BCAP 31; BCAP31; BCR associated protein Bap 31; BCR associated protein Bap31; BCR-associated protein 31; CDM; CDM protein; DXS1357E; MS950; p28; p28 Bap31; Protein CDM; RP23-329M9.5
Target Background
This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in caspase 8-mediated apoptosis. Microdeletions in this gene are associated with contiguous ABCD1/DXS1375E deletion syndrome (CADDS), a neonatal disorder. Alternative splicing of this gene results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 16.
Notification