-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TCEB3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 679-798 of human TCEB3 (NP_003189.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TCEB3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 679-798 of human TCEB3 (NP_003189.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02754A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TCEB3 |
| Target Synonyms | SIII; TCEB3; TCEB3A; SIII p110 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, BT-474, Mouse testis, Raji | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 679-798 of human TCEB3 (NP_003189.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ANKPKGRQAKMAFVNSVAKPPRDVRRRQEKFGTGGAAVPEKIKIKPAPYPMGSSHASASSISFNPSPEEPAYDGPSTSSAHLAPVVSSTVSYDPRKPTVKKIAPMMAKTIKAFKNRFSRR | Uniprot ID | Q14241 |
Uniprot Id
Q14241
Target Species
Human
Target Name
ELOA
Target Full Name
Elongin-A
Target Function
SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex).
Target Subcellular Location
Nucleus.
Target Synonyms
Ela1; Elo A; EloA; ELOA1_HUMAN; Elongin 110 kDa subunit; Elongin-A; ElonginA; RNA polymerase II transcription factor SIII subunit A1; SIII; SIII p110; TCEB 3; Tceb3; TCEB3A; Transcription elongation factor B (SIII) polypeptide 3 (110kD); Transcription elongation factor B (SIII) polypeptide 3; Transcription elongation factor B alpha subunit; Transcription elongation factor B polypeptide 3
Target Background
This gene encodes the protein elongin A, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation.
Notification