Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SPINT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-197 of human SPINT2 (NP_066925.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SPINT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-197 of human SPINT2 (NP_066925.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02861A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SPINT2 |
| Target Synonyms | PB; Kop; HAI2; DIAR3; HAI-2; SPINT2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 28-197 of human SPINT2 (NP_066925.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSK | Uniprot ID | O43291 |
Uniprot Id
O43291
Target Species
Human
Target Name
SPINT2
Target Full Name
Kunitz-type protease inhibitor 2
Target Function
Inhibitor of HGF activator. Also inhibits plasmin, plasma and tissue kallikrein, and factor XIa.
Target Involvement
Diarrhea 3, secretory sodium, congenital, with or without other congenital anomalies (DIAR3)
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Expressed in placenta, kidney, pancreas, prostate, testis, thymus, and trachea.
Target Synonyms
SPINT2; HAI2; KOP; Kunitz-type protease inhibitor 2; Hepatocyte growth factor activator inhibitor type 2; HAI-2; Placental bikunin
Target Background
This gene encodes a transmembrane protein with two extracellular Kunitz domains that inhibits a variety of serine proteases. The protein inhibits HGF activator which prevents the formation of active hepatocyte growth factor. This gene is a putative tumor suppressor, and mutations in this gene result in congenital sodium diarrhea. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
