Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HMGN1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGN1 (NP_004956.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against HMGN1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGN1 (NP_004956.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-03149A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HMGN1 |
| Target Synonyms | HMG14; HMGN1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, HepG2 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGN1 (NP_004956.5). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD | Uniprot ID | P05114 |
Uniprot Id
P05114
Target Species
Human
Target Name
HMGN1
Target Full Name
Non-histone chromosomal protein HMG-14
Target Function
Binds to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer. May be involved in the process which maintains transcribable genes in a unique chromatin conformation. Inhibits the phosphorylation of nucleosomal histones H3 and H2A by RPS6KA5/MSK1 and RPS6KA3/RSK2.
Target Subcellular Location
Nucleus. Cytoplasm. Note=Cytoplasmic enrichment upon phosphorylation. The RNA edited version localizes to the nucleus.
Target Protein Families
HMGN family
Target Synonyms
HMGN1; HMG14; Non-histone chromosomal protein HMG-14; High mobility group nucleosome-binding domain-containing protein 1
Target Background
The protein encoded by this gene binds nucleosomal DNA and is associated with transcriptionally active chromatin. Along with a similar protein, HMG17, the encoded protein may help maintain an open chromatin configuration around transcribable genes.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
