-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NUCB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 321-420 of human NUCB2 (NP_005004.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NUCB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 321-420 of human NUCB2 (NP_005004.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03163A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Nucb2 |
| Target Synonyms | NEFA; HEL-S-109; NUCB2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 321-420 of human NUCB2 (NP_005004.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ATEKKEFLEPDSWETLDQQQFFTEEELKEYENIIALQENELKKKADELQKQKEELQRQHDQLEAQKLEYHQVIQQMEQKKLQQGIPPSGPAGELKFEPHI | Uniprot ID | P80303 |
Uniprot Id
P80303
Target Species
Human
Target Name
NUCB2
Target Full Name
Nucleobindin-2
Target Function
Calcium-binding protein which may have a role in calcium homeostasis. Acts as a non-receptor guanine nucleotide exchange factor which binds to and activates guanine nucleotide-binding protein (G-protein) alpha subunit GNAI3.; Anorexigenic peptide, seems to play an important role in hypothalamic pathways regulating food intake and energy homeostasis, acting in a leptin-independent manner. May also exert hypertensive roles and modulate blood pressure through directly acting on peripheral arterial resistance.
Target Subcellular Location
Golgi apparatus. Membrane; Peripheral membrane protein. Cytoplasm. Secreted. Endoplasmic reticulum. Nucleus envelope. Note=Golgi retention is mediated by its N-terminal region.; [Nesfatin-1]: Secreted.
Target Protein Families
Nucleobindin family
Target Tissue Specificity
Predominantly expressed in spleen, testis and normal stomach.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
DNA binding protein NEFA; DNA-binding protein NEFA; Gastric cancer antigen Zg4; HEL S 109; NEFA; Nefastin 1; Nefastin-1; Nefastin1; Nucb2; NUCB2_HUMAN; Nucleobindin 2; Nucleobindin-2; Nucleobinding 2; Prepronefastin; Prepronesfatin
Target Background
This gene encodes a protein with a suggested role in calcium level maintenance, eating regulation in the hypothalamus, and release of tumor necrosis factor from vascular endothelial cells. This protein binds calcium and has EF-folding domains.
Notification