-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ERCC6L was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human ERCC6L (NP_060139.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ERCC6L was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human ERCC6L (NP_060139.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03177A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ERCC6L |
| Target Synonyms | PICH; RAD26L; ERCC6L | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549, Jurkat | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human ERCC6L (NP_060139.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KDATPGEKALGFKISENLMAIIKPYFLRRTKEDVQKKKSSNPEARLNEKNPDVDAICEMPSLSRKNDLIIWIRLVPLQEEIYRKFVSLDHIKELLMETRSP | Uniprot ID | Q2NKX8 |
Uniprot Id
Q2NKX8
Target Species
Human
Target Name
ERCC6L
Target Full Name
DNA excision repair protein ERCC-6-like
Target Function
DNA helicase that acts as a tension sensor that associates with catenated DNA which is stretched under tension until it is resolved during anaphase. Functions as ATP-dependent DNA translocase. Can promote Holliday junction branch migration (in vitro).
Target Subcellular Location
Chromosome, centromere. Chromosome, centromere, kinetochore. Chromosome.
Target Protein Families
SNF2/RAD54 helicase family
Target Synonyms
ATP dependent helicase ERCC6 like; ATP-dependent helicase ERCC6-like; DNA excision repair protein ERCC 6 like; DNA excision repair protein ERCC-6-like; ERC6L_HUMAN; ERCC 6L; Ercc6l; Excision repair cross complementing rodent repair deficiency complementation group 6 like; Excision repair protein ERCC6 like; FLJ20105; MGC131695; PICH; Plk1 interacting checkpoint helicase; PLK1-interacting checkpoint helicase; SNF2/RAD54 family protein; Tumor antigen BJ HCC 15; Tumor antigen BJ-HCC-15
Target Background
This gene encodes a member of the SWItch/Sucrose Non-Fermentable (SWI/SNF2) family of proteins, and contains a SNF2-like ATPase domain and a PICH family domain. One distinguishing feature of this SWI/SNF protein family member is that during interphase, the protein is excluded from the nucleus, and only associates with chromatin after the nuclear envelope has broken down. This protein is a DNA translocase that is thought to bind double-stranded DNA that is exposed to stretching forces, such as those exerted by the mitotic spindle. This protein associates with ribosomal DNA and ultra-fine DNA bridges (UFBs), fine structures that connect sister chromatids during anaphase at some sites such as fragile sites, telomeres and centromeres. This gene is required for the faithful segregation of sister chromatids during mitosis, and the ATPase activity of this protein required for the resolution of UFBs before cytokinesis.
Notification