Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PGK2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 242-360 of human PGK2 (NP_620061.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against PGK2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 242-360 of human PGK2 (NP_620061.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-03350A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PGK2 |
| Target Synonyms | PGKB; PGKPS; HEL-S-272; dJ417L20.2; PGK2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat brain, HepG2, Jurkat, Mouse brain, Mouse testis, Rat testis, U-87MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 242-360 of human PGK2 (NP_620061.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YTFLKVLNNMEIGASLFDEEGAKIVKDIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGPLGVFEWDAFAKGTKALMDEIV | Uniprot ID | P07205 |
Uniprot Id
P07205
Target Species
Human
Target Name
PGK2
Target Full Name
Phosphoglycerate kinase 2
Target Function
Essential for sperm motility and male fertility. Not required for the completion of spermatogenesis.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Phosphoglycerate kinase family
Target Tissue Specificity
Mainly found in round spermatids. Localized on the principle piece in the sperm (at protein level). Testis-specific. Expression significantly decreased in the testis of elderly men.
Target Synonyms
dJ417L20.2; PGK 2; pgk2; PGK2_HUMAN; PGKB; PGKPS; Phosphoglycerate kinase 2; Phosphoglycerate kinase; Phosphoglycerate kinase autosomal pseudogene; Phosphoglycerate kinase testis specific; testis specific
Target Background
This gene is intronless, arose via retrotransposition of the phosphoglycerate kinase 1 gene, and is expressed specifically in the testis. Initially assumed to be a pseudogene, the encoded protein is actually a functional phosphoglycerate kinase that catalyzes the reversible conversion of 1, 3-bisphosphoglycerate to 3-phosphoglycerate, during the Embden-Meyerhof-Parnas pathway of glycolysis, in the later stages of spermatogenesis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
