Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TWEAKR/Fn14/CD266 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-129 of human TWEAKR/Fn14/CD266 (NP_057723.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TWEAKR/Fn14/CD266 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-129 of human TWEAKR/Fn14/CD266 (NP_057723.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03424A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TWEAKR/Fn14/CD266 |
| Target Synonyms | FN14; CD266; TWEAKR; TWEAKR/Fn14/CD266 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-1080 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 28-129 of human TWEAKR/Fn14/CD266 (NP_057723.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ | Uniprot ID | Q9NP84 |
Uniprot Id
Q9NP84
Target Species
Human
Target Name
TNFRSF12A
Target Full Name
Tumor necrosis factor receptor superfamily member 12A
Target Function
Receptor for TNFSF12/TWEAK. Weak inducer of apoptosis in some cell types. Promotes angiogenesis and the proliferation of endothelial cells. May modulate cellular adhesion to matrix proteins.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Highly expressed in heart, placenta and kidney. Intermediate expression in lung, skeletal muscle and pancreas.
Target Synonyms
CD 266; CD266; CD266 antigen; FGF inducible 14; FGF-inducible 14; Fibroblast growth factor inducible immediate early response protein 14; Fibroblast growth factor-inducible immediate-early response protein 14; FN 14; FN14; TNFRSF 12A; TNFRSF12A; TNR12_HUMAN; Tumor necrosis factor receptor superfamily member 12A; TWEAK R; Tweak receptor; Tweak-receptor; TweakR
Target Background
Involved in positive regulation of extrinsic apoptotic signaling pathway and regulation of wound healing. Predicted to be located in cell surface and ruffle. Predicted to be active in plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
