Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HEATR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human HEATR1 (NP_060542.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HEATR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human HEATR1 (NP_060542.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03431A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HEATR1 |
| Target Synonyms | BAP28; UTP10; HEATR1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human HEATR1 (NP_060542.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTSLAQQLQRLALPQSDASLLSRDEVASLLFDPKEAATIDRDTAFAIGCTGLEELLGIDPSFEQFEAPLFSQLAKTLERSVQTKAVNKQLDENISLFLIHLSPYFLLKPAQKCLEWLIHR | Uniprot ID | Q9H583 |
Uniprot Id
Q9H583
Target Species
Human
Target Name
HEATR1
Target Full Name
HEAT repeat-containing protein 1
Target Function
Ribosome biogenesis factor. Involved in nucleolar processing of pre-18S ribosomal RNA. Required for optimal pre-ribosomal RNA transcription by RNA polymerase I.
Target Subcellular Location
Nucleus, nucleolus.
Target Protein Families
HEATR1/UTP10 family
Target Synonyms
HEATR1; BAP28; UTP10HEAT repeat-containing protein 1; Protein BAP28; U3 small nucleolar RNA-associated protein 10 homolog) [Cleaved into: HEAT repeat-containing protein 1; N-terminally processed]
Target Background
Enables RNA binding activity. Involved in positive regulation of rRNA processing and positive regulation of transcription by RNA polymerase I. Located in fibrillar center and mitochondrion. Implicated in pancreatic ductal carcinoma. Biomarker of glioblastoma.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
