-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HTATIP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human HTATIP2 (NP_006401.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HTATIP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human HTATIP2 (NP_006401.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03661A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HTATIP2 |
| Target Synonyms | CC3; TIP30; SDR44U1; HTATIP2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | LO2 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human HTATIP2 (NP_006401.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWASGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP | Uniprot ID | Q9BUP3 |
Uniprot Id
Q9BUP3
Target Species
Human
Target Name
HTATIP2
Target Full Name
Oxidoreductase HTATIP2
Target Function
Oxidoreductase required for tumor suppression. NAPDH-bound form inhibits nuclear import by competing with nuclear import substrates for binding to a subset of nuclear transport receptors. May act as a redox sensor linked to transcription through regulation of nuclear import. Isoform 1 is a metastasis suppressor with proapoptotic as well as antiangiogenic properties. Isoform 2 has an antiapoptotic effect.
Target Subcellular Location
Cytoplasm. Nucleus envelope.
Target Tissue Specificity
Ubiquitous. Highest level in liver. High levels in lung, skeletal muscle, pancreas and placenta. Moderate levels in heart and kidney. Low levels in brain. Not expressed or low levels in variant small cell lung carcinomas, 33% of hepatocellular carcinomas
Target Synonyms
30 kDa HIV 1 TAT interacting protein; 30 kDa HIV-1 TAT-interacting protein; 30 kDa HIV1 TAT interacting protein; CC3; FLJ26963; HIV 1 Tat interacting protein 2 30kDa; HIV 1 Tat interacting protein 2; HIV-1 TAT-interactive protein 2; HTAI2_HUMAN; HTATIP 2; HTATIP2; Oxidoreductase HTATIP2; SDR44U1; Short chain dehydrogenase/reductase family 44U member 1; Tat interacting protein (30kDa)
Target Background
Enables protein serine/threonine kinase activity. Involved in import into nucleus and regulation of angiogenesis. Acts upstream of or within positive regulation of programmed cell death; positive regulation of transcription by RNA polymerase II; and protein autophosphorylation. Located in cytosol and nuclear envelope.
Notification